Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340411.1 | 5prime_partial | 189 | 743-174(-) |
Amino Acid sequence : | |||
ANAQRKIGIAVDLSDESAIAVKWAVHHYIRPGDAVILVHVRPTSVLYGADWGSVDLSIVDTENEESQKKLEIDFDTFTTTKASDLSQPLMEAQIPFKIHIVKDHDMKERLCLEVERLGLS AVIMGSRGFGATKRGSDGRLGSVSDYCVRHCVCPVIVVRYPDEKDNAPVASVASAAEDEAESHDARKDS* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 14,824.765 | ||
Theoretical pI: | 5.185 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.402 | ||
aromaticity | 0.022 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.219 | ||
sheet | 0.292 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340411.1 | complete | 137 | 195-608(+) |
Amino Acid sequence : | |||
MRLSLILCGGSHRRNRSVILLIRISDDDNRTDAVPDAVVADAAKPAVASPLGGTESAAPHYDSAQPQPLHLQAQPLLHVVILHNVDFERDLSLHQRLRQIGCFCGGERVEIDLELLLRLL VLSVDDGEVDGAPIGTV* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,824.765 | ||
Theoretical pI: | 5.185 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.402 | ||
aromaticity | 0.022 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.219 | ||
sheet | 0.292 |