| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340424.1 | 5prime_partial | 221 | 721-56(-) |
Amino Acid sequence : | |||
| SPGGAIEAIRDEWSLFIFPGWMSKHRNQSSTSAFGSRTALSKEQITELAAALESTNCVFLWVLKGKKVDKEDKEEIAEMVGEAFLEKTKGKGMVVKGWVDQERILAHPAVGGFVSHCGWN SVTEAAAMGVPVVAWPTHGDQRVNAAVVEEMGLGVWERGWGWLGERLIGKDEIAEKLGGLMGDERMRKTAKMVREKAMEARERGGSSEMTIQGLIQSLQGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 16,144.680 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 90.836 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.274 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340424.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
| YILLQCRQIPLQHKNCRLSHALQRLNQSLNRHLRTPASLSCFHRFLSHHLRRLPHPLISHQTPQLLRNLIFSDQPLPQPPPPPLPHSQSHLLHHRRVHPLISMGRPRHHRNPHRRRLRHR IPPAVAHEPPHRWMS* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 16,144.680 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 90.836 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.274 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340424.1 | 5prime_partial | 221 | 721-56(-) |
Amino Acid sequence : | |||
| SPGGAIEAIRDEWSLFIFPGWMSKHRNQSSTSAFGSRTALSKEQITELAAALESTNCVFLWVLKGKKVDKEDKEEIAEMVGEAFLEKTKGKGMVVKGWVDQERILAHPAVGGFVSHCGWN SVTEAAAMGVPVVAWPTHGDQRVNAAVVEEMGLGVWERGWGWLGERLIGKDEIAEKLGGLMGDERMRKTAKMVREKAMEARERGGSSEMTIQGLIQSLQGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 16,144.680 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 90.836 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.274 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340424.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
| YILLQCRQIPLQHKNCRLSHALQRLNQSLNRHLRTPASLSCFHRFLSHHLRRLPHPLISHQTPQLLRNLIFSDQPLPQPPPPPLPHSQSHLLHHRRVHPLISMGRPRHHRNPHRRRLRHR IPPAVAHEPPHRWMS* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 16,144.680 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 90.836 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.274 | ||
| sheet | 0.215 | ||