| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340437.1 | 3prime_partial | 256 | 83-850(+) |
Amino Acid sequence : | |||
| MVFHRSAALLTKLRSTAVQQPGLRNSVRWFQVQTSSEDLHSQLKELIPEQQERLKKIKSEYGKVQLGNITVDMVLGGMRGMTGLLWETSLLDADEGIRFRGLSIPECQKLLPAAKPGGEP LPEGLLWLLLTGKVPTKEQVDSLSKELRSRATVPDHVYKAIDALPITAHPMTQFTTGVMALQVQSEFQKAYEKGIHKSKYWEPTYEDSLSLIAQLPIVASYIYRRLYKNGQVITMDDSLN YGANFAHMLGFTDPAM | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,732.867 | ||
| Theoretical pI: | 8.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
| Instability index: | 39.265 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.215 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340437.1 | 3prime_partial | 256 | 83-850(+) |
Amino Acid sequence : | |||
| MVFHRSAALLTKLRSTAVQQPGLRNSVRWFQVQTSSEDLHSQLKELIPEQQERLKKIKSEYGKVQLGNITVDMVLGGMRGMTGLLWETSLLDADEGIRFRGLSIPECQKLLPAAKPGGEP LPEGLLWLLLTGKVPTKEQVDSLSKELRSRATVPDHVYKAIDALPITAHPMTQFTTGVMALQVQSEFQKAYEKGIHKSKYWEPTYEDSLSLIAQLPIVASYIYRRLYKNGQVITMDDSLN YGANFAHMLGFTDPAM | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,732.867 | ||
| Theoretical pI: | 8.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
| Instability index: | 39.265 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.215 | ||
| sheet | 0.293 | ||