| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340440.1 | internal | 247 | 2-742(+) |
Amino Acid sequence : | |||
| HAVKMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAAS LSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMREL VRQTDYV | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,693.617 | ||
| Theoretical pI: | 6.583 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 37.932 | ||
| aromaticity | 0.138 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.267 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340440.1 | internal | 247 | 2-742(+) |
Amino Acid sequence : | |||
| HAVKMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAAS LSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMREL VRQTDYV | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,693.617 | ||
| Theoretical pI: | 6.583 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 37.932 | ||
| aromaticity | 0.138 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.267 | ||
| sheet | 0.259 | ||