| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340441.1 | 5prime_partial | 238 | 739-23(-) |
Amino Acid sequence : | |||
| ADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKD PEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNIKGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 16,727.203 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 58.168 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.289 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340441.1 | 5prime_partial | 149 | 2-451(+) |
Amino Acid sequence : | |||
| SPNVERVLMPFNVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARD YLQLLRIFDGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,727.203 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 58.168 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.289 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340441.1 | 5prime_partial | 238 | 739-23(-) |
Amino Acid sequence : | |||
| ADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKD PEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNIKGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 16,727.203 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 58.168 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.289 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340441.1 | 5prime_partial | 149 | 2-451(+) |
Amino Acid sequence : | |||
| SPNVERVLMPFNVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARD YLQLLRIFDGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,727.203 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 58.168 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.289 | ||
| sheet | 0.195 | ||