Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340450.1 | 3prime_partial | 134 | 404-3(-) |
Amino Acid sequence : | |||
MDMVDPSTPLPPWFTEEDLEIYGSLYRNSGFKTALKIPYRYMSEVFNVPNEKVEVPALLIMGEKDYFFKFPGVEDYIRNEHGKAFVPKLEPVYVPEGSHFVQEQFPEQINHLVLTFVKNN IRRQIDHVFERFGL | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,868.919 | ||
Theoretical pI: | 4.883 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 54.826 | ||
aromaticity | 0.129 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.169 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340450.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
QAESLENMVNLPSNVVLDKGENQVIDLFRKLLLHKMTAFRDIHWLELWDERLPVFVPDVVLHAGELEEVIFLPHDQQCWNFNFLIWHIENFRHIPVRNFESCFETRVPVEGAIDFQILFC EPRW* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,868.919 | ||
Theoretical pI: | 4.883 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 54.826 | ||
aromaticity | 0.129 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.169 | ||
sheet | 0.274 |