Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340451.1 | 5prime_partial | 189 | 602-33(-) |
Amino Acid sequence : | |||
PIGGLTSLSTWGYIEAVREIQEQLQKENFCSAFDDIVVACGSGCTSTGLALGSQLSGLAAQVHSYSVWGEAHYFHENEYAQGLLDGLEAGLSSRDILNFKDCKGLGYAITTGEELKFVKE IAEKTGVILDHVYSGKAAYQMMRDMSDDPMRWQGRKVLFIHTGGLFSLFHKAHDLASLVGNWRNMNIYE* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 13,461.295 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 29.221 | ||
aromaticity | 0.120 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.222 | ||
sheet | 0.197 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340451.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
HANPIVDMQILLIDVHVTPIPNQRSQVMGFVEQAEETTGVYEENFSPLPSHWIITHVSHHLICSLSTINMIENYASFFSNFFHKFKLLSRSYSVAETFTIFKVENVTRAKTCFKSVK* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,461.295 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 29.221 | ||
aromaticity | 0.120 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.222 | ||
sheet | 0.197 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340451.1 | 5prime_partial | 189 | 602-33(-) |
Amino Acid sequence : | |||
PIGGLTSLSTWGYIEAVREIQEQLQKENFCSAFDDIVVACGSGCTSTGLALGSQLSGLAAQVHSYSVWGEAHYFHENEYAQGLLDGLEAGLSSRDILNFKDCKGLGYAITTGEELKFVKE IAEKTGVILDHVYSGKAAYQMMRDMSDDPMRWQGRKVLFIHTGGLFSLFHKAHDLASLVGNWRNMNIYE* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 13,461.295 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 29.221 | ||
aromaticity | 0.120 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.222 | ||
sheet | 0.197 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340451.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
HANPIVDMQILLIDVHVTPIPNQRSQVMGFVEQAEETTGVYEENFSPLPSHWIITHVSHHLICSLSTINMIENYASFFSNFFHKFKLLSRSYSVAETFTIFKVENVTRAKTCFKSVK* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,461.295 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 29.221 | ||
aromaticity | 0.120 | ||
GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.222 | ||
sheet | 0.197 |