| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340451.1 | 5prime_partial | 189 | 602-33(-) |
Amino Acid sequence : | |||
| PIGGLTSLSTWGYIEAVREIQEQLQKENFCSAFDDIVVACGSGCTSTGLALGSQLSGLAAQVHSYSVWGEAHYFHENEYAQGLLDGLEAGLSSRDILNFKDCKGLGYAITTGEELKFVKE IAEKTGVILDHVYSGKAAYQMMRDMSDDPMRWQGRKVLFIHTGGLFSLFHKAHDLASLVGNWRNMNIYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,461.295 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 29.221 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.222 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340451.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| HANPIVDMQILLIDVHVTPIPNQRSQVMGFVEQAEETTGVYEENFSPLPSHWIITHVSHHLICSLSTINMIENYASFFSNFFHKFKLLSRSYSVAETFTIFKVENVTRAKTCFKSVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,461.295 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 29.221 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.222 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340451.1 | 5prime_partial | 189 | 602-33(-) |
Amino Acid sequence : | |||
| PIGGLTSLSTWGYIEAVREIQEQLQKENFCSAFDDIVVACGSGCTSTGLALGSQLSGLAAQVHSYSVWGEAHYFHENEYAQGLLDGLEAGLSSRDILNFKDCKGLGYAITTGEELKFVKE IAEKTGVILDHVYSGKAAYQMMRDMSDDPMRWQGRKVLFIHTGGLFSLFHKAHDLASLVGNWRNMNIYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,461.295 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 29.221 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.222 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340451.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| HANPIVDMQILLIDVHVTPIPNQRSQVMGFVEQAEETTGVYEENFSPLPSHWIITHVSHHLICSLSTINMIENYASFFSNFFHKFKLLSRSYSVAETFTIFKVENVTRAKTCFKSVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,461.295 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 29.221 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.222 | ||
| sheet | 0.197 | ||