Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340453.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
RRKPIYHYLSVTAPSNHPTTTKNPSALWLLPLEWLHNFPCEVGIVSPKMPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVHKHRQRLRDTDGVRDLHDAPPC EPVGNDALGHLPDNVGATPVDLGGVLPGEGPAAVGPPPAVSANDDLTAGEI* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 16,745.920 | ||
Theoretical pI: | 9.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 12.292 | ||
aromaticity | 0.110 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.299 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340453.1 | 5prime_partial | 154 | 538-74(-) |
Amino Acid sequence : | |||
IGGPHGYSDFSGRKIIIGTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQVAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSN GRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,745.920 | ||
Theoretical pI: | 9.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 12.292 | ||
aromaticity | 0.110 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.299 | ||
sheet | 0.143 |