| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340467.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| HAVEMYANFCFRLAADLPDLSVDNEKITFKRLLLNKCQEEFERGEREEEEANKVEEEGEVKQSAEEREEKRLRARRRMLGNIRLIGELYKKRMLTERIMHECINKLLGQYQNPDEENIEA LCKLMSTIGEMIDHPKAKEHMDAYYDIMAQLSNNMKISSRVRFMLKDAIDLRKNKWQQRRKVEGPKKIEEVHRDAAQERARLGRTPSMGNSGRRGHPMDFGPRSPSVLPSPSSQIGGFRG PPQQLRGYGSQDVXTDERHSSVP | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 30,410.268 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 69.884 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.221 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340467.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| HAVEMYANFCFRLAADLPDLSVDNEKITFKRLLLNKCQEEFERGEREEEEANKVEEEGEVKQSAEEREEKRLRARRRMLGNIRLIGELYKKRMLTERIMHECINKLLGQYQNPDEENIEA LCKLMSTIGEMIDHPKAKEHMDAYYDIMAQLSNNMKISSRVRFMLKDAIDLRKNKWQQRRKVEGPKKIEEVHRDAAQERARLGRTPSMGNSGRRGHPMDFGPRSPSVLPSPSSQIGGFRG PPQQLRGYGSQDVXTDERHSSVP | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 30,410.268 | ||
| Theoretical pI: | 8.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 69.884 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.967 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.221 | ||
| sheet | 0.302 | ||