Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340474.1 | complete | 180 | 162-704(+) |
Amino Acid sequence : | |||
MAPSASDLNGTIVLKPHAIPKWEISGFVEYIKAGQQQGDMLLVVPEGYAAVRLGNEASIKQLLNVTKGMFYSLTFSAARTCAQEERVNVSVAPDFGVMPIQTLYSSNGWDSYAWAFKAFY SVAEILIHNPGVEEDPACGPLIDSIAIRALYPPRPTNRKFAPMILPPCLTFWHSNYESYA* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 12,095.956 | ||
Theoretical pI: | 8.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 42.625 | ||
aromaticity | 0.071 | ||
GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.321 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340474.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
MEASFPSLTAAYPSGTTSNMSPCCCPALMYSTKPEISHFGIAWGLSTMVPLRSEALGAISKLPLSNSPAYISHMIISNYQAPIQNMTGNVTIKKSSKVISHHVHLETLCIHF | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,095.956 | ||
Theoretical pI: | 8.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 42.625 | ||
aromaticity | 0.071 | ||
GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.321 | ||
sheet | 0.250 |