| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340482.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPAEKPLIVVNYKGEEKQFAAEEI SSMVLMKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,057.606 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.112 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340482.1 | 5prime_partial | 99 | 715-416(-) |
Amino Acid sequence : | |||
| VVKIFTSKMSVTSSGLHLKDPFLNGQKRNIKGTTTKIKNQDILLTNTGCLLVKTISNSRSSWLIDDTHYIKTSNDTSILGSLTLRIIEVCWDSDHSILH* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,057.606 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.112 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340482.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPAEKPLIVVNYKGEEKQFAAEEI SSMVLMKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,057.606 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.112 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340482.1 | 5prime_partial | 99 | 715-416(-) |
Amino Acid sequence : | |||
| VVKIFTSKMSVTSSGLHLKDPFLNGQKRNIKGTTTKIKNQDILLTNTGCLLVKTISNSRSSWLIDDTHYIKTSNDTSILGSLTLRIIEVCWDSDHSILH* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,057.606 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 48.112 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.141 | ||