| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340502.1 | complete | 140 | 96-518(+) |
Amino Acid sequence : | |||
| MGVYIILIKSRMQLDDGSNHTFTISGMCTGYLSMQSCHGPSTGDLIVRLHFHTDAGALKIHSQIAICHTQFPFFILPIAAMNTNSYHSDDDDVLPNRWSGILDASTCSADSCKFFCSSAI TALPPAWMQKCSNACLKSGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,235.352 | ||
| Theoretical pI: | 6.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15970 | ||
| Instability index: | 43.001 | ||
| aromaticity | 0.086 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.264 | ||
| sheet | 0.200 | ||