Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340510.1 | 5prime_partial | 241 | 743-18(-) |
Amino Acid sequence : | |||
ASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVTWPRLDLCK VDLTFKSPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEQIGSLDTFKVVELTCDKHRAELVASPSLAEIVHYDLWAWDYAVSLRRSPGPTRALVGQLHSFSSSFHYIFRFS W* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,054.598 | ||
Theoretical pI: | 5.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52035 | ||
Instability index: | 41.274 | ||
aromaticity | 0.108 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.266 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340510.1 | 5prime_partial | 241 | 743-18(-) |
Amino Acid sequence : | |||
ASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVTWPRLDLCK VDLTFKSPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEQIGSLDTFKVVELTCDKHRAELVASPSLAEIVHYDLWAWDYAVSLRRSPGPTRALVGQLHSFSSSFHYIFRFS W* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,054.598 | ||
Theoretical pI: | 5.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52035 | ||
Instability index: | 41.274 | ||
aromaticity | 0.108 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.216 | ||
sheet | 0.266 |