| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340527.1 | 5prime_partial | 203 | 702-91(-) |
Amino Acid sequence : | |||
| HEEYKDLPAFFMGESMGGLLTMLMYFQSAEEGLWTGLIFLAPLFVFPEPMVPFKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYPGKPRVGTMRELVRQTDYVQR NFDKVKVPFLVLHGPLDGLAEVSGSEMLYQKASSEDKILKLYEGMYHFLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 15,732.068 | ||
| Theoretical pI: | 9.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 48.982 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340527.1 | complete | 141 | 94-519(+) |
Amino Acid sequence : | |||
| MGTTVGTISLNSSINPSPHISQHKISILIGLTLHQKVIHPFIQFQNLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,732.068 | ||
| Theoretical pI: | 9.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 48.982 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.191 | ||