Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340535.1	5prime_partial	167	2-505(+)
Amino Acid sequence :
HHVTYHLKCKFKCHIQLETMKIFYNTNKLRKTSHGESSLIQAVKHPHCTSFIQHNFNINNAGELLIRCHSHLPVGQCFHLHHLMAHKETCGNAFVVEWAVALAGEPPVVLSASVHLAFPK PSQQSRNRHVHDPSKSMAVSWALIHHISSLQIPLPVVVMALPCQHPP*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		12,749.964
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		64.714
aromaticity		0.043
GRAVY		-1.330
Secondary Structure Fraction
Helix		0.138
turn		0.284
sheet		0.267

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340535.1	3prime_partial	131	394-2(-)
Amino Acid sequence :
MNVPISTLLTGLWESKVDRSRKDHWRLSGQSYSPLNNKRVTASLLVRHQMVKMETLANRKMRVATNKKLSCIVDIKVVLNKRRAMRMFYCLYKGGFAMRGLPELIRVVEYFHGFQLNMTF EFTFQMISYVV
Physicochemical properties
Number of amino acids:		131
Molecular weight:		12,749.964
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		64.714
aromaticity		0.043
GRAVY		-1.330
Secondary Structure Fraction
Helix		0.138
turn		0.284
sheet		0.267

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340535.1	complete	116	545-195(-)
Amino Acid sequence :
MSGAEEVKDHPEVVMEDADKAMPSPQQEEESVKKKYGGLMPKKQPLISKDHERAYFDSADWALGKQGGQKPKGPLEALRPKLQPTQQQTRYRKSPCAPSDGEDGNTGQPEDASGNE*
Physicochemical properties
Number of amino acids:		116
Molecular weight:		12,749.964
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		64.714
aromaticity		0.043
GRAVY		-1.330
Secondary Structure Fraction
Helix		0.138
turn		0.284
sheet		0.267