Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340536.1	5prime_partial	167	565-62(-)
Amino Acid sequence :
HEETYHLKCKFKCHIQMETMKIVYNTNKLRKTSHGESSLIQAVKHPHCTSFIQHNFNINNAGELLIRCHSHLPVGQCFHLHHLMAHKETCGNAFVVEWAVALAGEPPVVLSASVHLAFPK PSQQSRNRHVHDPSKSMAVSWALIHHISSLQIPLPVVVMALPCQHPP*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		12,776.001
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		66.944
aromaticity		0.043
GRAVY		-1.359
Secondary Structure Fraction
Helix		0.138
turn		0.293
sheet		0.259

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340536.1	3prime_partial	131	173-565(+)
Amino Acid sequence :
MNVPISTLLTGLWESKVDRSRKDHWRLSGQSYSPLNNKRVTASLLVRHQMVKMETLANRKMRVATNKKLSCIVDIKVVLNKRRAMRMFYCLYKGGFAMRGLPELIRVVDYFHGFHLNMTF EFTFQMISFLV
Physicochemical properties
Number of amino acids:		131
Molecular weight:		12,776.001
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		66.944
aromaticity		0.043
GRAVY		-1.359
Secondary Structure Fraction
Helix		0.138
turn		0.293
sheet		0.259

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340536.1	complete	116	22-372(+)
Amino Acid sequence :
MSGPEEVKDHPEVVMEDADKAMPSPQQEEESVKKKYGGLMPKKQPLISKDHERAYFDSADWALGKQGGQKPKGPLEALRPKLQPTQQQTRYRKSPCAPSDGEDGNTGQPEDASGNE*
Physicochemical properties
Number of amino acids:		116
Molecular weight:		12,776.001
Theoretical pI:		5.265
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		66.944
aromaticity		0.043
GRAVY		-1.359
Secondary Structure Fraction
Helix		0.138
turn		0.293
sheet		0.259