| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340541.1 | 3prime_partial | 238 | 21-734(+) |
Amino Acid sequence : | |||
| MAAEGSMPRVKLGSQGLEVSKLGYGCMGLTGFYNAPISVEDGVAIVKEAFNKGITFFDTADIYGKDHANEYLIGQALKELPREKVQIATKFGFYAFTSSGIVIKGTPEYARSCCEASLKH LQVDYIDLYYIHRIDTTVPIEETMEELKKLVEEGKIKYIGLSEANADTIRRAHAVHPITAVQMEYSLWTRDIEEEIIPLCRELGIGIVPYCPVGRGLFAGKKVVENIPQESHLQSHPR | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,473.125 | ||
| Theoretical pI: | 5.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
| Instability index: | 40.219 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.206 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340541.1 | 3prime_partial | 238 | 21-734(+) |
Amino Acid sequence : | |||
| MAAEGSMPRVKLGSQGLEVSKLGYGCMGLTGFYNAPISVEDGVAIVKEAFNKGITFFDTADIYGKDHANEYLIGQALKELPREKVQIATKFGFYAFTSSGIVIKGTPEYARSCCEASLKH LQVDYIDLYYIHRIDTTVPIEETMEELKKLVEEGKIKYIGLSEANADTIRRAHAVHPITAVQMEYSLWTRDIEEEIIPLCRELGIGIVPYCPVGRGLFAGKKVVENIPQESHLQSHPR | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,473.125 | ||
| Theoretical pI: | 5.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
| Instability index: | 40.219 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.206 | ||
| sheet | 0.269 | ||