| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340566.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| HAVKAGVDIWQYVFALPPMAAVKCAVDLQIADILEGHGGAMSLSELSSATGCSPSSLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKLSSR TLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVL HDWG | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 18,638.021 | ||
| Theoretical pI: | 10.487 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.267 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340566.1 | 5prime_partial | 166 | 733-233(-) |
Amino Acid sequence : | |||
| TPVMQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSL IGEGARAQLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,638.021 | ||
| Theoretical pI: | 10.487 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.267 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340566.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| HAVKAGVDIWQYVFALPPMAAVKCAVDLQIADILEGHGGAMSLSELSSATGCSPSSLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKLSSR TLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVL HDWG | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 18,638.021 | ||
| Theoretical pI: | 10.487 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.267 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340566.1 | 5prime_partial | 166 | 733-233(-) |
Amino Acid sequence : | |||
| TPVMQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSL IGEGARAQLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,638.021 | ||
| Theoretical pI: | 10.487 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.267 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.472 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.241 | ||
| sheet | 0.259 | ||