Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340596.1 | complete | 143 | 142-573(+) |
Amino Acid sequence : | |||
MIIIIIKCLNFFRLAIVVIGNGEDDHRDGLFVQNGCPSHLMLVKHLVNWFRLIVIALQHESKMDMRKMCPIFGSSAESFPVANIWILGLDSLNLLLNELIVCRWNTLPLLRRTIHKSVDE SGRLDLHSRVPSRGGPHAHSVFS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 12,611.301 | ||
Theoretical pI: | 10.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 50.802 | ||
aromaticity | 0.084 | ||
GRAVY | -0.965 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.280 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340596.1 | complete | 107 | 552-229(-) |
Amino Acid sequence : | |||
MGSSSRWNPRMQIQPPTFINRLVNRPPEKRQRVPSAYNQFIKEEIQRIKAKNPDISHREAFSTAAKNWAHFPHIHFGLMLESNNNQPKPINEVFDKHQMRRAAVLNK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,611.301 | ||
Theoretical pI: | 10.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 50.802 | ||
aromaticity | 0.084 | ||
GRAVY | -0.965 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.280 | ||
sheet | 0.206 |