| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340610.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| PLPVCDWDDKWIDIYLDNSVKLLDICIAFTSEISRLTQGHLFLQCLLHDLDSDSSEKFVRARSSLDGWRQHMGSNNSKLDSIFSVMDSLVRTLDLPKVKNSSKAKVLFRSMYGVKIVTLF ICSVLAAAFTRLDKNPIDLPVPETFTWAPAFSDLKTHINSEIRNAMSIYLKEVEAVESGVREIDPIVVGNSVEQRPFEGETLKRLNSGLGESVGELSRGL | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,441.240 | ||
| Theoretical pI: | 9.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 84.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340610.1 | complete | 106 | 363-43(-) |
Amino Acid sequence : | |||
| MKRVTILTPYMDRNKTFAFDEFLTFGRSSVRTRLSMTEKMLSSFELFEPICCLHPSSEERARTNFSEESLSRSCRRHCKKRWPCVSREISEVNAMQISSSFTLLSK* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,441.240 | ||
| Theoretical pI: | 9.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 84.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340610.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| PLPVCDWDDKWIDIYLDNSVKLLDICIAFTSEISRLTQGHLFLQCLLHDLDSDSSEKFVRARSSLDGWRQHMGSNNSKLDSIFSVMDSLVRTLDLPKVKNSSKAKVLFRSMYGVKIVTLF ICSVLAAAFTRLDKNPIDLPVPETFTWAPAFSDLKTHINSEIRNAMSIYLKEVEAVESGVREIDPIVVGNSVEQRPFEGETLKRLNSGLGESVGELSRGL | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,441.240 | ||
| Theoretical pI: | 9.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 84.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340610.1 | complete | 106 | 363-43(-) |
Amino Acid sequence : | |||
| MKRVTILTPYMDRNKTFAFDEFLTFGRSSVRTRLSMTEKMLSSFELFEPICCLHPSSEERARTNFSEESLSRSCRRHCKKRWPCVSREISEVNAMQISSSFTLLSK* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,441.240 | ||
| Theoretical pI: | 9.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 84.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||