Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340648.1 | complete | 121 | 159-524(+) |
Amino Acid sequence : | |||
MAEGQAVGENDNQQGNDGNRGNGNEHEGQAAQGEGGNRLWVIVKEIQMIVFGFITSLLPSFHNVLHYAVHNPKAFWQFDLPTLSRGIPFFFLGWGANPTKLASKLCKITHCYRFKRTIVI I* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,527.269 | ||
Theoretical pI: | 8.688 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 18.558 | ||
aromaticity | 0.116 | ||
GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.273 | ||
sheet | 0.207 |