| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340648.1 | complete | 121 | 159-524(+) |
Amino Acid sequence : | |||
| MAEGQAVGENDNQQGNDGNRGNGNEHEGQAAQGEGGNRLWVIVKEIQMIVFGFITSLLPSFHNVLHYAVHNPKAFWQFDLPTLSRGIPFFFLGWGANPTKLASKLCKITHCYRFKRTIVI I* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,527.269 | ||
| Theoretical pI: | 8.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 18.558 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.273 | ||
| sheet | 0.207 | ||