| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340649.1 | internal | 251 | 755-3(-) |
Amino Acid sequence : | |||
| GGDEDVRLRDHILKAEHLEALHEGLQGADGVDLGHDHAGPGLLQGGCAPLADVSVAEDNAHLSGDHHVGRPHEAVGERVPASVQAVELAFSARVVNVNGGEKQSAISLHLIQPLNASRRL LRNAHQSVLHLRINGGILLQSIFDNRHHDLKFGVVGGARIRQLPALGVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLESLPLPGEDGGAVARDDVRRRGPAWRRCCR RASGPRPRAEF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 13,842.870 | ||
| Theoretical pI: | 5.316 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 19.825 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.200 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340649.1 | 3prime_partial | 130 | 366-755(+) |
Amino Acid sequence : | |||
| MKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSGTKSKFDGLYGCRHSLPDGLMRATDVMIAGKVGVVFGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGFQVLRLEDV VSEADIFVTT | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,842.870 | ||
| Theoretical pI: | 5.316 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 19.825 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.200 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340649.1 | internal | 251 | 755-3(-) |
Amino Acid sequence : | |||
| GGDEDVRLRDHILKAEHLEALHEGLQGADGVDLGHDHAGPGLLQGGCAPLADVSVAEDNAHLSGDHHVGRPHEAVGERVPASVQAVELAFSARVVNVNGGEKQSAISLHLIQPLNASRRL LRNAHQSVLHLRINGGILLQSIFDNRHHDLKFGVVGGARIRQLPALGVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLESLPLPGEDGGAVARDDVRRRGPAWRRCCR RASGPRPRAEF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 13,842.870 | ||
| Theoretical pI: | 5.316 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 19.825 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.200 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340649.1 | 3prime_partial | 130 | 366-755(+) |
Amino Acid sequence : | |||
| MKDRLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSGTKSKFDGLYGCRHSLPDGLMRATDVMIAGKVGVVFGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGFQVLRLEDV VSEADIFVTT | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,842.870 | ||
| Theoretical pI: | 5.316 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 19.825 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.200 | ||
| sheet | 0.269 | ||