| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340656.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| PTATTAEVPQSLKKELSGDCRACFSAHAVNNHVEFVREYKQDFERDLDPQSTATFPATLADLTERLKHWKNILPSNVEDRFPAVLKLEDESRVLRDFHVVDVEVPRQYFADQEVAPDHTV KLDRVGPDIPIGRRHGSSFRRL | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,250.012 | ||
| Theoretical pI: | 5.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.547 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.623 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.183 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340656.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| PTATTAEVPQSLKKELSGDCRACFSAHAVNNHVEFVREYKQDFERDLDPQSTATFPATLADLTERLKHWKNILPSNVEDRFPAVLKLEDESRVLRDFHVVDVEVPRQYFADQEVAPDHTV KLDRVGPDIPIGRRHGSSFRRL | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,250.012 | ||
| Theoretical pI: | 5.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.547 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.623 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.183 | ||
| sheet | 0.239 | ||