| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340658.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| ARPLKRHKKKKKKKMSTFVISNSMHVGISFSFLHKLPQTPPPQVVCCSGGLRLRPSCSLQLQPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKMILKEEKMEALQ QLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLYFTALGFRLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFLLREGEDTLEFARQFATKFL QKKLHDNDNSLI | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 29,525.323 | ||
| Theoretical pI: | 8.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 64.381 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.650 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.198 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340658.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| ARPLKRHKKKKKKKMSTFVISNSMHVGISFSFLHKLPQTPPPQVVCCSGGLRLRPSCSLQLQPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKMILKEEKMEALQ QLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLYFTALGFRLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFLLREGEDTLEFARQFATKFL QKKLHDNDNSLI | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 29,525.323 | ||
| Theoretical pI: | 8.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 64.381 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.650 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.198 | ||
| sheet | 0.262 | ||