Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340658.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
ARPLKRHKKKKKKKMSTFVISNSMHVGISFSFLHKLPQTPPPQVVCCSGGLRLRPSCSLQLQPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKMILKEEKMEALQ QLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLYFTALGFRLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFLLREGEDTLEFARQFATKFL QKKLHDNDNSLI | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 29,525.323 | ||
Theoretical pI: | 8.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 64.381 | ||
aromaticity | 0.103 | ||
GRAVY | -0.650 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.198 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340658.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
ARPLKRHKKKKKKKMSTFVISNSMHVGISFSFLHKLPQTPPPQVVCCSGGLRLRPSCSLQLQPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKMILKEEKMEALQ QLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLYFTALGFRLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFLLREGEDTLEFARQFATKFL QKKLHDNDNSLI | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 29,525.323 | ||
Theoretical pI: | 8.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 64.381 | ||
aromaticity | 0.103 | ||
GRAVY | -0.650 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.198 | ||
sheet | 0.262 |