Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340676.1 | 3prime_partial | 241 | 48-770(+) |
Amino Acid sequence : | |||
MEADMKLDKWGYQVRTCSDACLSAINSYYHQVLSYGRKRSVILEAPKSDPECVLGNILAAHFLCSAGSARAPELIDAAKSHLQYASSYEKGVFEAVNYLISPDRDDDLAVQMHSQLLRDF PRDLLSLKRAQVLCFYMGRPDLSLELVEQVLPINDREEYIYGMLAFPLLELGRMRDAEKAGKRGYEIKSEDSWSQHALCHVYQYECRFKEAVDFMINCAGSWGSLSSFMYTHNWWHVSLC Y | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,625.211 | ||
Theoretical pI: | 5.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49850 50350 | ||
Instability index: | 41.831 | ||
aromaticity | 0.116 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.203 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340676.1 | 3prime_partial | 241 | 48-770(+) |
Amino Acid sequence : | |||
MEADMKLDKWGYQVRTCSDACLSAINSYYHQVLSYGRKRSVILEAPKSDPECVLGNILAAHFLCSAGSARAPELIDAAKSHLQYASSYEKGVFEAVNYLISPDRDDDLAVQMHSQLLRDF PRDLLSLKRAQVLCFYMGRPDLSLELVEQVLPINDREEYIYGMLAFPLLELGRMRDAEKAGKRGYEIKSEDSWSQHALCHVYQYECRFKEAVDFMINCAGSWGSLSSFMYTHNWWHVSLC Y | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,625.211 | ||
Theoretical pI: | 5.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49850 50350 | ||
Instability index: | 41.831 | ||
aromaticity | 0.116 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.203 | ||
sheet | 0.303 |