| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340678.1 | 5prime_partial | 193 | 3-584(+) |
Amino Acid sequence : | |||
| VIPEKYLDENSIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIEQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIV KESFYFRPGMISINLYLKRGSNGRFLKTAAYGHFGRDDPDFTWEVVKPLKLGEATNADGCASCGWMGEWFRIE* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 16,209.959 | ||
| Theoretical pI: | 4.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 46.731 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.261 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340678.1 | 3prime_partial | 153 | 461-3(-) |
Amino Acid sequence : | |||
| MPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLEDLLVGDLPRPVRVDKHRQRLRHTDGVRDLLDAPPGEPVGDDALGRLPDDVGATPVDLGGVLPREGPATVGPPPAVGVDDDLTA GETRVAVGPTDDEPPGGIQVEDGVLVQILLGDH | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,209.959 | ||
| Theoretical pI: | 4.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 46.731 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.261 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340678.1 | 5prime_partial | 193 | 3-584(+) |
Amino Acid sequence : | |||
| VIPEKYLDENSIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIEQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIV KESFYFRPGMISINLYLKRGSNGRFLKTAAYGHFGRDDPDFTWEVVKPLKLGEATNADGCASCGWMGEWFRIE* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 16,209.959 | ||
| Theoretical pI: | 4.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 46.731 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.261 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340678.1 | 3prime_partial | 153 | 461-3(-) |
Amino Acid sequence : | |||
| MPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLEDLLVGDLPRPVRVDKHRQRLRHTDGVRDLLDAPPGEPVGDDALGRLPDDVGATPVDLGGVLPREGPATVGPPPAVGVDDDLTA GETRVAVGPTDDEPPGGIQVEDGVLVQILLGDH | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,209.959 | ||
| Theoretical pI: | 4.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 46.731 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.261 | ||
| sheet | 0.255 | ||