| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340726.1 | 3prime_partial | 174 | 244-765(+) |
Amino Acid sequence : | |||
| MAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLG GYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTELPWDNSGAAHP | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,692.988 | ||
| Theoretical pI: | 4.717 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42970 42970 | ||
| Instability index: | 48.956 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.241 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340726.1 | 3prime_partial | 174 | 244-765(+) |
Amino Acid sequence : | |||
| MAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLG GYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTELPWDNSGAAHP | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,692.988 | ||
| Theoretical pI: | 4.717 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42970 42970 | ||
| Instability index: | 48.956 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.241 | ||
| sheet | 0.322 | ||