| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340732.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
| IHEGVKAEEAFEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGV VCGYGDVGKGCAAYSTLLGAPVIL | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,509.679 | ||
| Theoretical pI: | 7.867 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 20.835 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.155 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.236 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340732.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
| IHEGVKAEEAFEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGV VCGYGDVGKGCAAYSTLLGAPVIL | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,509.679 | ||
| Theoretical pI: | 7.867 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 20.835 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.155 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.236 | ||
| sheet | 0.257 | ||