Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340736.1 | 5prime_partial | 173 | 3-524(+) |
Amino Acid sequence : | |||
PRLRPYTIDNRKMGYDFERIDLPWQDYRPPRQTAKAKINRASAPKPPKARSLFPLKLDKVVRFEVDKTTKGVADESILLENITVDTSKFLKFDVFVNDEDDAPNELDKAAYAGTYAQVPH KSDNGKATSSIKLRLTELYEDMDIDDDDSIVVTIVPRHEGPGVTIGGIKIVAN* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 14,486.119 | ||
Theoretical pI: | 8.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 35.893 | ||
aromaticity | 0.123 | ||
GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.362 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340736.1 | complete | 138 | 496-80(-) |
Amino Acid sequence : | |||
MVTPGPSWRGTIVTTIESSSSMSISSYSSVNLSFIDDVAFPLSLLCGTCAYVPAYAALSNSFGASSSSFTNTSNFKNFDVSTVMFSSKIDSSATPFVVLSTSNLTTLSSFSGKRDRAFGG LGAEARFIFAFAVCRGGR* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,486.119 | ||
Theoretical pI: | 8.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 35.893 | ||
aromaticity | 0.123 | ||
GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.362 | ||
sheet | 0.188 |