| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340740.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| GLPMSYASLLDEGTAAAEAMAMCNNIQKGKKKTFVIASNCHPQTIDICQTRADGFELKVVVSDLKDIDYSSGDVCGVLVQYPGTEGEILDYGEFIKNAHANGVKVVMASDLLALTMLKPP GELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKDIAQRVHGLAGTFAAGLKKL G | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,187.759 | ||
| Theoretical pI: | 11.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 64.810 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.286 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340740.1 | internal | 241 | 724-2(-) |
Amino Acid sequence : | |||
| PKLFQSSGKCPSQAVYPLSNVFEAFGSVVDSIHSSHVGQQSLSCADVASRLVTTNVLLPSLHSHTKSRLPRRINTHTNNPSRHHPLILLRSSQERRMGPTIPHRNTKSLSRTNHNISPQL TRRLQHRQSQQIRSHHNLHTISMSVLDELPIVQNLPLSSRVLNQHTTHITRAVIDVLQIRNHHLKLKSISSSLTDINRLRVAVASNHERLLLPLLNVVAHRHRLCSGSPFIEQRGVGHRQ T | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,187.759 | ||
| Theoretical pI: | 11.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 64.810 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.286 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340740.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| GLPMSYASLLDEGTAAAEAMAMCNNIQKGKKKTFVIASNCHPQTIDICQTRADGFELKVVVSDLKDIDYSSGDVCGVLVQYPGTEGEILDYGEFIKNAHANGVKVVMASDLLALTMLKPP GELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKDIAQRVHGLAGTFAAGLKKL G | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,187.759 | ||
| Theoretical pI: | 11.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 64.810 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.286 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340740.1 | internal | 241 | 724-2(-) |
Amino Acid sequence : | |||
| PKLFQSSGKCPSQAVYPLSNVFEAFGSVVDSIHSSHVGQQSLSCADVASRLVTTNVLLPSLHSHTKSRLPRRINTHTNNPSRHHPLILLRSSQERRMGPTIPHRNTKSLSRTNHNISPQL TRRLQHRQSQQIRSHHNLHTISMSVLDELPIVQNLPLSSRVLNQHTTHITRAVIDVLQIRNHHLKLKSISSSLTDINRLRVAVASNHERLLLPLLNVVAHRHRLCSGSPFIEQRGVGHRQ T | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,187.759 | ||
| Theoretical pI: | 11.787 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 64.810 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.286 | ||
| sheet | 0.191 | ||