Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340745.1 | 5prime_partial | 135 | 420-13(-) |
Amino Acid sequence : | |||
FPAGVFVALMMAQIEILRKKGPSFSEIINERGIEFVDPLNPFRPARGVSFMGDNCLPTARLGSRKWPPRFDYILPQQALVPVDNAPPINPALISTFLFAPVPGPIEGGAQLRPPVAISVP PDADFVPPGVGQSPN* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,510.716 | ||
Theoretical pI: | 6.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 70.632 | ||
aromaticity | 0.089 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.348 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340745.1 | 5prime_partial | 135 | 420-13(-) |
Amino Acid sequence : | |||
FPAGVFVALMMAQIEILRKKGPSFSEIINERGIEFVDPLNPFRPARGVSFMGDNCLPTARLGSRKWPPRFDYILPQQALVPVDNAPPINPALISTFLFAPVPGPIEGGAQLRPPVAISVP PDADFVPPGVGQSPN* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,510.716 | ||
Theoretical pI: | 6.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 70.632 | ||
aromaticity | 0.089 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.348 | ||
sheet | 0.222 |