| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340762.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| TRHSLTYSFRSTQKGSERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEI VYTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQ | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,160.176 | ||
| Theoretical pI: | 8.541 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.093 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.271 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340762.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| TRHSLTYSFRSTQKGSERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEI VYTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQ | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,160.176 | ||
| Theoretical pI: | 8.541 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.093 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.271 | ||
| sheet | 0.238 | ||