Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340767.1 | 5prime_partial | 226 | 1-681(+) |
Amino Acid sequence : | |||
ARGMTSAMRISALSEAGVIYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGSYKVAVQNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGT GSELEIAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAVTARVSIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 13,592.378 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 57.367 | ||
aromaticity | 0.093 | ||
GRAVY | 0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.372 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340767.1 | complete | 129 | 638-249(-) |
Amino Acid sequence : | |||
MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISNSEPVPIKITSGLLPDELSEMVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,592.378 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 57.367 | ||
aromaticity | 0.093 | ||
GRAVY | 0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.372 | ||
sheet | 0.287 |