| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340769.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HEANLMRVREEGLVVRRRLQLMLYNIMYTMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAID HIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAW WLS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,813.603 | ||
| Theoretical pI: | 5.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.051 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340769.1 | 3prime_partial | 113 | 340-2(-) |
Amino Acid sequence : | |||
| MLFSVFSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHRVHDVIEHELQPPPNNQPFLSDPHEVRLV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,813.603 | ||
| Theoretical pI: | 5.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.051 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340769.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HEANLMRVREEGLVVRRRLQLMLYNIMYTMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAID HIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAW WLS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,813.603 | ||
| Theoretical pI: | 5.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.051 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340769.1 | 3prime_partial | 113 | 340-2(-) |
Amino Acid sequence : | |||
| MLFSVFSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHRVHDVIEHELQPPPNNQPFLSDPHEVRLV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,813.603 | ||
| Theoretical pI: | 5.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.051 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.292 | ||