| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340773.1 | 3prime_partial | 204 | 56-667(+) |
Amino Acid sequence : | |||
| MGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAHNCWVKKGGAYTGEVSADMLVNLNVPWVILGHSERRALLNESNEFVGEKVAYALSQ GLKVIACIGETLEQRESGTTVYVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLHANVNAEVASS | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,257.223 | ||
| Theoretical pI: | 6.217 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39085 | ||
| Instability index: | 30.104 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.225 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340773.1 | 3prime_partial | 204 | 56-667(+) |
Amino Acid sequence : | |||
| MGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAHNCWVKKGGAYTGEVSADMLVNLNVPWVILGHSERRALLNESNEFVGEKVAYALSQ GLKVIACIGETLEQRESGTTVYVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLHANVNAEVASS | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,257.223 | ||
| Theoretical pI: | 6.217 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39085 | ||
| Instability index: | 30.104 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.225 | ||
| sheet | 0.279 | ||