| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340775.1 | 3prime_partial | 243 | 63-791(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPLRLPLQD VYK | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,648.303 | ||
| Theoretical pI: | 6.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.353 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.296 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340775.1 | 3prime_partial | 115 | 347-3(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVLGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSIKQGRYESRENFEAELK | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,648.303 | ||
| Theoretical pI: | 6.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.353 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.296 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340775.1 | 3prime_partial | 243 | 63-791(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPLRLPLQD VYK | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,648.303 | ||
| Theoretical pI: | 6.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.353 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.296 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340775.1 | 3prime_partial | 115 | 347-3(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVLGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSIKQGRYESRENFEAELK | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,648.303 | ||
| Theoretical pI: | 6.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 28.353 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.296 | ||
| sheet | 0.278 | ||