| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340776.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| VYLSLSQRQMASKPFSICVVIFALLIFVSEKKADNEADRIASLPGQPAVNFRQYSGYITVDEKQQRSYFYYFVEAETEPASKPLVLWLNGGPGCSSIGAGAFGEHGPFQPSGNVLVKNDY SWNKVANMLYLESPAGVGFSYSANKSFYESVNDEMTARDNLVFLENWMEKFPEFKNRKFYISGESYGGHYVPQLANLILESKSNINLTGIAIGNPLLEFTTDFNSRAEFLWSHGLISDST YFEFTYSCNYSQIRRQA | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,992.215 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45840 45965 | ||
| Instability index: | 43.843 | ||
| aromaticity | 0.152 | ||
| GRAVY | -0.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.296 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340776.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| VYLSLSQRQMASKPFSICVVIFALLIFVSEKKADNEADRIASLPGQPAVNFRQYSGYITVDEKQQRSYFYYFVEAETEPASKPLVLWLNGGPGCSSIGAGAFGEHGPFQPSGNVLVKNDY SWNKVANMLYLESPAGVGFSYSANKSFYESVNDEMTARDNLVFLENWMEKFPEFKNRKFYISGESYGGHYVPQLANLILESKSNINLTGIAIGNPLLEFTTDFNSRAEFLWSHGLISDST YFEFTYSCNYSQIRRQA | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,992.215 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45840 45965 | ||
| Instability index: | 43.843 | ||
| aromaticity | 0.152 | ||
| GRAVY | -0.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.296 | ||
| sheet | 0.237 | ||