Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340790.1 | complete | 181 | 131-676(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,370.465 | ||
Theoretical pI: | 5.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.519 | ||
aromaticity | 0.071 | ||
GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.186 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340790.1 | 5prime_partial | 156 | 752-282(-) |
Amino Acid sequence : | |||
DEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTA EWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,370.465 | ||
Theoretical pI: | 5.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.519 | ||
aromaticity | 0.071 | ||
GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.186 | ||
sheet | 0.244 |