| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340791.1 | 5prime_partial | 185 | 755-198(-) |
Amino Acid sequence : | |||
| AACVWRCRTIALSPKPDEVMRFLCAIDMRNRMNPPLPEGYYGNVSVAPAAITTAGELTKKPLDYAVELVREAKRQGTDEYVRSVADLMVMRGRPSFTTARTYMVSNFTRAGFEQVDFGWG TAAYGGPAKGFHLPTPLSCYIGFKNKMGEEGIVVPERLPLAAMEEFEKQLRLIMAADSDFNVSKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 13,057.102 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 81.147 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.193 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340791.1 | complete | 109 | 360-689(+) |
Amino Acid sequence : | |||
| MKPFRRAAVRRRAPPKVHLLETRTREIRNHISPRRRKTGPTSHHHQIRYRSHVLIRPLSLRLPHQLHRVVQGLFRQFTCSRNGCRSNRHIAVVALRQRRVHSVSHIDRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,057.102 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 81.147 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.193 | ||
| sheet | 0.156 | ||