| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340796.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
| VNSQTYSFRSTQKACERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEIV YTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQA YEALNNAGFLDANLIVVLNDNKTSSLPTA | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,155.492 | ||
| Theoretical pI: | 6.960 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 43.367 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.271 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340796.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
| VNSQTYSFRSTQKACERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELREEIV YTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQA YEALNNAGFLDANLIVVLNDNKTSSLPTA | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,155.492 | ||
| Theoretical pI: | 6.960 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 43.367 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.271 | ||
| sheet | 0.253 | ||