| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340798.1 | 5prime_partial | 199 | 1-600(+) |
Amino Acid sequence : | |||
| ARPFKPNSARGALIERHRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYKQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFK KIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 22,812.019 | ||
| Theoretical pI: | 6.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 48.550 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.196 | ||
| sheet | 0.266 | ||