Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340798.1 | 5prime_partial | 199 | 1-600(+) |
Amino Acid sequence : | |||
ARPFKPNSARGALIERHRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYKQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFK KIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,812.019 | ||
Theoretical pI: | 6.146 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
Instability index: | 48.550 | ||
aromaticity | 0.111 | ||
GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.196 | ||
sheet | 0.266 |