| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340800.1 | 3prime_partial | 251 | 73-825(+) |
Amino Acid sequence : | |||
| MNLPKQNQESMLRESIKHFLTSYHSGSSDYTSFESIFFRLIQTMLDPPLEITWFYAATTFHAAKLSSPPSRVLVAKDLFNLMISCSNLSSASKKIALLAPVVYDLYSVVCTREIEPCEKV GAGKLVEKIVDYAMVSAGGYEDVECDNAVVCFEDLIRVWTTDRGGGGCSFVESLRLFFPLLSDGIWKRIGPGCGTWELAGIVLLEVFLLRVCVFFSSGMCTEDVLKETREQAVKIIKGFR NCYFLDLLLKM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 12,711.299 | ||
| Theoretical pI: | 11.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.574 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.229 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340800.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
| TVKFPLNSKFHVQHARNHQILRHYEPPEAKPGIHAARIDQAFPNFIPQRQLRLHLIRVDFLPFNPDNARSAARNHLVLRRHHIPRRQTEQSSLQGAGSQGFVQFNDLVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,711.299 | ||
| Theoretical pI: | 11.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.574 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.229 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340800.1 | 3prime_partial | 251 | 73-825(+) |
Amino Acid sequence : | |||
| MNLPKQNQESMLRESIKHFLTSYHSGSSDYTSFESIFFRLIQTMLDPPLEITWFYAATTFHAAKLSSPPSRVLVAKDLFNLMISCSNLSSASKKIALLAPVVYDLYSVVCTREIEPCEKV GAGKLVEKIVDYAMVSAGGYEDVECDNAVVCFEDLIRVWTTDRGGGGCSFVESLRLFFPLLSDGIWKRIGPGCGTWELAGIVLLEVFLLRVCVFFSSGMCTEDVLKETREQAVKIIKGFR NCYFLDLLLKM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 12,711.299 | ||
| Theoretical pI: | 11.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.574 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.229 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340800.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
| TVKFPLNSKFHVQHARNHQILRHYEPPEAKPGIHAARIDQAFPNFIPQRQLRLHLIRVDFLPFNPDNARSAARNHLVLRRHHIPRRQTEQSSLQGAGSQGFVQFNDLVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,711.299 | ||
| Theoretical pI: | 11.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.574 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.229 | ||
| sheet | 0.202 | ||