Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340824.1 | internal | 167 | 2-502(+) |
Amino Acid sequence : | |||
PPLRIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDNKMVGMAIKDPEKLKVI ASNPMRYTGKPRVGTMRESARQTDYLQRNFDKVKVPFLVLHGILDGL | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,744.922 | ||
Theoretical pI: | 9.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 38.647 | ||
aromaticity | 0.114 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.240 | ||
sheet | 0.305 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340824.1 | internal | 167 | 2-502(+) |
Amino Acid sequence : | |||
PPLRIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDNKMVGMAIKDPEKLKVI ASNPMRYTGKPRVGTMRESARQTDYLQRNFDKVKVPFLVLHGILDGL | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,744.922 | ||
Theoretical pI: | 9.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 38.647 | ||
aromaticity | 0.114 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.240 | ||
sheet | 0.305 |