| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340824.1 | internal | 167 | 2-502(+) |
Amino Acid sequence : | |||
| PPLRIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDNKMVGMAIKDPEKLKVI ASNPMRYTGKPRVGTMRESARQTDYLQRNFDKVKVPFLVLHGILDGL | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,744.922 | ||
| Theoretical pI: | 9.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.647 | ||
| aromaticity | 0.114 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.240 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340824.1 | internal | 167 | 2-502(+) |
Amino Acid sequence : | |||
| PPLRIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDNKMVGMAIKDPEKLKVI ASNPMRYTGKPRVGTMRESARQTDYLQRNFDKVKVPFLVLHGILDGL | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,744.922 | ||
| Theoretical pI: | 9.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 38.647 | ||
| aromaticity | 0.114 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.240 | ||
| sheet | 0.305 | ||