| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340835.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| RLSQNINSSVCVWLASFLIIIDAVMAFQDHHLSPEMPLHHPHYSDHHSSSVFLPDHKPPASTWLNASALHHQWLPTQSQPSPTANSDHLQDSGGAGDKTNSNANWERDKCKADILNHPLY EQLLSAHVSCLRIATPVDQLPRIDAQLAQSQQVVARYSVLGHGQQPLDDKDLDNFMTHYVLLLASFKEQLQQHVRVHAMEAVMACWELEQSLQSLTGVAPGEGTGATMSDDDEDQADSEA NLFDESMD | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 17,311.024 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.431 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340835.1 | complete | 164 | 535-41(-) |
Amino Acid sequence : | |||
| MCHEIIEVFIIERLLTMAKNRVSGHHLLRLRQLGVDSRQLVHGRSDSQAGDVRRQKLLVQGVVENIRLALVSLPVGVAVGLVPGAAAVLEVIAVGGGAGLTLRRKPLMVESGGVEPGRGG RLVVGKKDGGGVVVGIVGMVEGHFWGEVVVLEGHHCVNDDEEAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,311.024 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.431 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340835.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| RLSQNINSSVCVWLASFLIIIDAVMAFQDHHLSPEMPLHHPHYSDHHSSSVFLPDHKPPASTWLNASALHHQWLPTQSQPSPTANSDHLQDSGGAGDKTNSNANWERDKCKADILNHPLY EQLLSAHVSCLRIATPVDQLPRIDAQLAQSQQVVARYSVLGHGQQPLDDKDLDNFMTHYVLLLASFKEQLQQHVRVHAMEAVMACWELEQSLQSLTGVAPGEGTGATMSDDDEDQADSEA NLFDESMD | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 17,311.024 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.431 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340835.1 | complete | 164 | 535-41(-) |
Amino Acid sequence : | |||
| MCHEIIEVFIIERLLTMAKNRVSGHHLLRLRQLGVDSRQLVHGRSDSQAGDVRRQKLLVQGVVENIRLALVSLPVGVAVGLVPGAAAVLEVIAVGGGAGLTLRRKPLMVESGGVEPGRGG RLVVGKKDGGGVVVGIVGMVEGHFWGEVVVLEGHHCVNDDEEAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,311.024 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 47.431 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||