| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340841.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| SPENSLSPPPYFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFR SVRVSEEYKDLPAFLVGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHVFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPTVGTMRELVRQTD YVQ | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,643.724 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 81.308 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.710 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.229 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340841.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
| VAGKFPFSAALLLGRHAGGRILRLPRRPQLQILLRNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYRLDVPEILHQLRQLGLRGVRRRHAGARPLRRDPRLHRRHE* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,643.724 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 81.308 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.710 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.229 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340841.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| SPENSLSPPPYFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFR SVRVSEEYKDLPAFLVGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHVFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPTVGTMRELVRQTD YVQ | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 12,643.724 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 81.308 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.710 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.229 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340841.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
| VAGKFPFSAALLLGRHAGGRILRLPRRPQLQILLRNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYRLDVPEILHQLRQLGLRGVRRRHAGARPLRRDPRLHRRHE* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,643.724 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 81.308 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.710 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.229 | ||
| sheet | 0.284 | ||