Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340848.1	complete	113	480-139(-)
Amino Acid sequence :
MSGIIHKIEEKLGMGGKKEDEKHGEDHKKAEHVQPQHGDHHKQPEHGAYGGDHYKQAEHGQSGEHKEGLVDKIKDKIGGGSGEGAEKKKKKKDKKKGEHGHDHGHSSSSSDSD*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		11,993.312
Theoretical pI:		10.061
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		37.939
aromaticity		0.054
GRAVY		1.039
Secondary Structure Fraction
Helix		0.441
turn		0.189
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340848.1	complete	111	304-639(+)
Amino Acid sequence :
MFRLLVVISTVGAVLGLLVVIAVLGLNVFGLFVILAVFLILLLASHTELLLDLVNDSRHFIFVSASCRIRHEASCRIGTRLKSQPESLPTARARQLEPKIAAAVAMISSSL*
Physicochemical properties
Number of amino acids:		111
Molecular weight:		11,993.312
Theoretical pI:		10.061
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		37.939
aromaticity		0.054
GRAVY		1.039
Secondary Structure Fraction
Helix		0.441
turn		0.189
sheet		0.351