| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340849.1 | 5prime_partial | 230 | 695-3(-) |
Amino Acid sequence : | |||
| GGGGDDFEFALVREDREISAAQLLYKGPVFPVFNRDLITENGAELSARNGGDRLESKNLIPLSKLFAEEDEERDSPPSCSSSEADELENIPAGMYCVWRPRMADPPMPSQCKKSKSTGSA SKRWKLRDFLRRSKSDGKESFVFLTPKPREEKPEKVMIQAPKKGDGGGSHWSAHEAFYVKNRAIKEGDKKKSYLPSRRDLVGLFGNVNRRAQEFFSHIELRSILQVWYVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 22,044.910 | ||
| Theoretical pI: | 10.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 57.836 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.313 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340849.1 | 5prime_partial | 198 | 2-598(+) |
Amino Acid sequence : | |||
| FNPRTTLEGLIGVLYVKKTPAHADLRYQKALPDLVWKADTISSYPLPLSLCSSRKKPHAPTNAILHHLLSSELGSLLSLVSLPGASESKTQNSPSRRFCSAARNREVSTAWMPIQSICSS YTGLASADPPSSAAKHSTCRPEYSPVRRPLTTNTMEESRAPRPPQRRVYSTVSNSSIRADRLRFWRSIQRRFLLSNRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,044.910 | ||
| Theoretical pI: | 10.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 57.836 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.313 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340849.1 | 5prime_partial | 230 | 695-3(-) |
Amino Acid sequence : | |||
| GGGGDDFEFALVREDREISAAQLLYKGPVFPVFNRDLITENGAELSARNGGDRLESKNLIPLSKLFAEEDEERDSPPSCSSSEADELENIPAGMYCVWRPRMADPPMPSQCKKSKSTGSA SKRWKLRDFLRRSKSDGKESFVFLTPKPREEKPEKVMIQAPKKGDGGGSHWSAHEAFYVKNRAIKEGDKKKSYLPSRRDLVGLFGNVNRRAQEFFSHIELRSILQVWYVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 22,044.910 | ||
| Theoretical pI: | 10.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 57.836 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.313 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340849.1 | 5prime_partial | 198 | 2-598(+) |
Amino Acid sequence : | |||
| FNPRTTLEGLIGVLYVKKTPAHADLRYQKALPDLVWKADTISSYPLPLSLCSSRKKPHAPTNAILHHLLSSELGSLLSLVSLPGASESKTQNSPSRRFCSAARNREVSTAWMPIQSICSS YTGLASADPPSSAAKHSTCRPEYSPVRRPLTTNTMEESRAPRPPQRRVYSTVSNSSIRADRLRFWRSIQRRFLLSNRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,044.910 | ||
| Theoretical pI: | 10.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 57.836 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.313 | ||
| sheet | 0.237 | ||