| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340855.1 | complete | 155 | 486-19(-) |
Amino Acid sequence : | |||
| MAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALVLNIHQSLAVIRIKTYIIGDKSNGTACVTDNLVVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGN LIAELVGVPLIHRLRCKQEGVHLSSLNLRSKEFQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 15,446.057 | ||
| Theoretical pI: | 4.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 44.490 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.190 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340855.1 | 3prime_partial | 142 | 61-486(+) |
Amino Acid sequence : | |||
| MDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYDKIVRDTCRAIGFVSDDVGLDADNCKALVNIEHQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSH | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,446.057 | ||
| Theoretical pI: | 4.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 44.490 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.190 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340855.1 | complete | 155 | 486-19(-) |
Amino Acid sequence : | |||
| MAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALVLNIHQSLAVIRIKTYIIGDKSNGTACVTDNLVVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGN LIAELVGVPLIHRLRCKQEGVHLSSLNLRSKEFQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 15,446.057 | ||
| Theoretical pI: | 4.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 44.490 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.190 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340855.1 | 3prime_partial | 142 | 61-486(+) |
Amino Acid sequence : | |||
| MDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYDKIVRDTCRAIGFVSDDVGLDADNCKALVNIEHQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSH | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,446.057 | ||
| Theoretical pI: | 4.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 44.490 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.190 | ||
| sheet | 0.246 | ||