| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340856.1 | 5prime_partial | 240 | 732-10(-) |
Amino Acid sequence : | |||
| EVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGK DPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,491.282 | ||
| Theoretical pI: | 7.006 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.832 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340856.1 | 3prime_partial | 112 | 397-732(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLSTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQICSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDL | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,491.282 | ||
| Theoretical pI: | 7.006 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.832 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340856.1 | 5prime_partial | 240 | 732-10(-) |
Amino Acid sequence : | |||
| EVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGK DPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,491.282 | ||
| Theoretical pI: | 7.006 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.832 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340856.1 | 3prime_partial | 112 | 397-732(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLSTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQICSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDL | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,491.282 | ||
| Theoretical pI: | 7.006 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.832 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.214 | ||
| sheet | 0.232 | ||