| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340868.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HEAEHHVTTLLALALLSCANTIISHFSLSLPLKICTFILFSFPLLPLIIDSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLASMSQKYGPLFMLKLGSKNLVIVSSPDLADQVLHT QGLEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVHDLRNDMRVREEGLVVTRRLQLMLYNIMYRMMFDAKFKSQTDP | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 19,839.342 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.226 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340868.1 | 5prime_partial | 177 | 685-152(-) |
Amino Acid sequence : | |||
| RISLRLEFGIKHHPVHDVIEHELQPPRNNQPFLSDPHVISQVVDDEVHLLLPHPAVVVHHLVGKKGEGHNAPHLAPVLPVHREHHVLPVAREYVEHHVAWPRSKLQPLSVEDLVREIRAG HDNQILGAQLQHEKGAVFLRHGGKEAVVQVVADLEPVAEYGHGCWPWWPRISSAGAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,839.342 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.226 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340868.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HEAEHHVTTLLALALLSCANTIISHFSLSLPLKICTFILFSFPLLPLIIDSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLASMSQKYGPLFMLKLGSKNLVIVSSPDLADQVLHT QGLEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVHDLRNDMRVREEGLVVTRRLQLMLYNIMYRMMFDAKFKSQTDP | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 19,839.342 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.226 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340868.1 | 5prime_partial | 177 | 685-152(-) |
Amino Acid sequence : | |||
| RISLRLEFGIKHHPVHDVIEHELQPPRNNQPFLSDPHVISQVVDDEVHLLLPHPAVVVHHLVGKKGEGHNAPHLAPVLPVHREHHVLPVAREYVEHHVAWPRSKLQPLSVEDLVREIRAG HDNQILGAQLQHEKGAVFLRHGGKEAVVQVVADLEPVAEYGHGCWPWWPRISSAGAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,839.342 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.226 | ||
| sheet | 0.254 | ||